Protein coding transcript 185901

• Transcript: Ll_transcript_902
• CDS coordinates: 201-923 (+)
• Peptide sequence: MAYHNQNHDLSQQEFSLHHFTNQSNSTPNWLNNTTTTTTTTTAAVNSSAQWKAEILGHPLYEQLLSAHVGCLRIATPVDQLPRIDAQLAQSEDVVAKYSNTFGPNMVAADKELDQFMSHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQTLTGVSPGEGTGATMSDDEDDQVESDANIFDVSLDGTDSMGFGPLVPTENERSLMERVRQELKHELKHVSNVVTFKMFFHLTNLPL*
• ORF Type: complete

Annotations of Ll_transcript_902

• Blastp: Homeobox protein knotted-1-like 3 from Arabidopsis with 76.04% of identity
• Blastx: Homeobox protein knotted-1-like 3 from Arabidopsis with 81.82% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT5G25220)
• CantataDB: Link to cantataDB annotations (CNT0001697)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447574.1)
• Pfam: KNOX1 domain (PF03790.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;