Transcript | Ll_transcript_905 |
---|---|
CDS coordinates | 201-590 (+) |
Peptide sequence | MAYHNQNHDLSQQEFSLHHFTNQSNSTPNWLNNTTTTTTTTTAAVNSSAQWKAEILGHPLYEQLLSAHVGCLRIATPVDQLPRIDAQLAQSEDVVAKYSNTFGPNMVAADKELDQFMVILREKIEPKKL* |
ORF Type | complete |
Blastp | Homeobox protein knotted-1-like 3 from Malus with 78.57% of identity |
---|---|
Blastx | Homeobox protein knotted-1-like 3 from Malus with 79.71% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447574.1) |
Pfam | KNOX1 domain (PF03790.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer