Protein coding transcript 185938

• Transcript: Ll_transcript_524
• CDS coordinates: 114-581 (+)
• Peptide sequence: MRSCFFSLKLQHSSLSLLPTHMSSSLSMLSLYPFSSFNHRFISNSFSSSSSSSSPQPPVIQTPSRVGFLGLGIMGSPMALNLIHSGIDVTVWNRTKTKCEPLINLGAKYKSSPEEVAASCDVTFAMLADPQSALDVAVGKHGAVNGMAPGKGSCV*
• ORF Type: complete

Annotations of Ll_transcript_524

• Blastp: Glyoxylate/succinic semialdehyde reductase 2, chloroplastic from Arabidopsis with 74.71% of identity
• Blastx: Glyoxylate/succinic semialdehyde reductase 2, chloroplastic from Arabidopsis with 83.76% of identity
• Eggnog: Dehydrogenase(COG2084)
• Kegg: Link to kegg annotations (AT1G17650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458371.1)
• Pfam: NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;