Transcript | Ll_transcript_527 |
---|---|
CDS coordinates | 219-521 (+) |
Peptide sequence | MVYVSMQTNYFIGMLYVSMQSKFYLGDVGNGAAMKLIVNMIMGRFFHNLSPAIYFHFSWANGSGDTNFSIFPMVHSMMASFSEGLVLSEKVGLDPNVLVQV |
ORF Type | 3prime_partial |
Blastp | Glyoxylate/succinic semialdehyde reductase 2, chloroplastic from Arabidopsis with 51.22% of identity |
---|---|
Blastx | Glyoxylate/succinic semialdehyde reductase 2, chloroplastic from Arabidopsis with 54.91% of identity |
Eggnog | Dehydrogenase(COG2084) |
Kegg | Link to kegg annotations (AT1G17650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458371.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer