Protein coding transcript 185940

• Transcript: Ll_transcript_527
• CDS coordinates: 219-521 (+)
• Peptide sequence: MVYVSMQTNYFIGMLYVSMQSKFYLGDVGNGAAMKLIVNMIMGRFFHNLSPAIYFHFSWANGSGDTNFSIFPMVHSMMASFSEGLVLSEKVGLDPNVLVQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_527

• Blastp: Glyoxylate/succinic semialdehyde reductase 2, chloroplastic from Arabidopsis with 51.22% of identity
• Blastx: Glyoxylate/succinic semialdehyde reductase 2, chloroplastic from Arabidopsis with 54.91% of identity
• Eggnog: Dehydrogenase(COG2084)
• Kegg: Link to kegg annotations (AT1G17650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458371.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;