Transcript | Ll_transcript_534302 |
---|---|
CDS coordinates | 1-519 (+) |
Peptide sequence | VIWISNRNPKGKPMTEGYFVSLMFILLFVGLSAQFVGQPAFFATFIFGVILPDGPPLGSVLSEKLDIIGSTLLVPAYITISGLNTGSVPILAGSRSAGIEMAILAGYIGKFVGTIIPSIHFQIQLWDSITLALIMSCRGILDLIIYYLLYNAKATDELIFSLQVYTMVLITGF |
ORF Type | internal |
Blastp | Cation/H(+) antiporter 14 from Arabidopsis with 34.57% of identity |
---|---|
Blastx | Cation/H(+) antiporter 14 from Arabidopsis with 38.57% of identity |
Eggnog | Sodium hydrogen exchanger(COG0475) |
Kegg | Link to kegg annotations (AT1G06970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439270.1) |
Pfam | Sodium/hydrogen exchanger family (PF00999.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer