Transcript | Ll_transcript_1398 |
---|---|
CDS coordinates | 1-633 (+) |
Peptide sequence | GLGRKANLVYIIDFGLAKRYRDSATNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKLSTPIEVLCKSHPVEFASYFHYCHSLMFEQRPDYGFLKRLFRDLFAREGYEFDFVFDWTILKYQQAQKNRVQPPISPIPGARNSNSNAMPMDVDNHQGWYILNNLSFLCIGCHF* |
ORF Type | 5prime_partial |
Blastp | Casein kinase 1-like protein 3 from Arabidopsis with 83.51% of identity |
---|---|
Blastx | Casein kinase 1-like protein 3 from Arabidopsis with 83.51% of identity |
Eggnog | Casein Kinase(ENOG410XPGP) |
Kegg | Link to kegg annotations (AT4G28880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446348.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer