Protein coding transcript 186011

• Transcript: Ll_transcript_1405
• CDS coordinates: 1-819 (+)
• Peptide sequence: GLGRKANLVYIIDFGLAKRYRDSATNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKVSTPIEALCKSHPVEFASYFHYCHSLIFDQRPDYGFLKRLFRDLFTREGYEFDYVFDWTILKYQQSQKNRVQPRISPVPGASNNHAMPMDLDNHRGDVSGRIRSSNATGSGVKIQFKSSVGKNLGSENPLGKNIFGEANVPSTSFSLAGTSRRTSLKPTMPTEAANHVHGQGSPFK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_1405

• Blastp: Casein kinase 1-like protein 3 from Arabidopsis with 69.31% of identity
• Blastx: Casein kinase 1-like protein 3 from Arabidopsis with 69.31% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28880)
• CantataDB: Link to cantataDB annotations (CNT0002396)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436617.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;