Transcript | Ll_transcript_1915 |
---|---|
CDS coordinates | 2-892 (+) |
Peptide sequence | IGQFGVGFYSAYLAADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLKEDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTIEKEISDDEDEEEKKEEEGKVEEVDEEKEKDEKKKKTIKEVSHEWSLVNKQKPIWMRKPEEITQDEYAAFYKSLTNDWEEHLAVKHFSVEGQLEFKAVLFVPKRAPFDLFDTKKKANNVKLYVRRVFITDNCEELMPEYLSFVKGIVDSEDLPLNISREMLQQNKILKVIRKNLVKKSIELFFEIAENKEDYTKFYEAFSK |
ORF Type | internal |
Blastp | Heat shock protein 83 from Ipomoea with 87.21% of identity |
---|---|
Blastx | Heat shock cognate protein 80 from Lycopersicon with 91.58% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (109146489) |
CantataDB | Link to cantataDB annotations (CNT0000451) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435703.1) |
Pfam | Hsp90 protein (PF00183.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer