Protein coding transcript 186073

• Transcript: Ll_transcript_2200
• CDS coordinates: 629-1141 (+)
• Peptide sequence: MTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKADSFSGEYLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELVKENNKSAASSKGKITLSVTKTKPETGEIIGVFESLQPSDTDLGAKAPKDVKIQGVWYAQLDS*
• ORF Type: complete

Annotations of Ll_transcript_2200

• Blastp: Oxygen-evolving enhancer protein 1, chloroplastic from Pisum with 95.29% of identity
• Blastx: Oxygen-evolving enhancer protein 1, chloroplastic from Pisum with 90.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000045)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421163.1)
• Pfam: Manganese-stabilising protein / photosystem II polypeptide (PF01716.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;