Protein coding transcript 186123

• Transcript: Ll_transcript_160256
• CDS coordinates: 306-1610 (+)
• Peptide sequence: MNQLVESSHRVSRVQAPLVDSVSCYCKVDSGLKTVAGARKFVPGSKLCIQPDINPNAHKRKNSRRERTRVQPPLLPGLPDDLAIACLIRVPRVEHRKLRIVCKRWYHLLSGNFFYSLRKSLGMAEEWVYVIKRDRDGKISLHAFDPIYQLWQSLPPVPGEYSEALGFGCSVLSGCHLYLFGGKDPMKGSMRRVIFYSARTNKWHRAPDMLRKRHLFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRWNFVSEMTMAMVPFIGVVHNGKWFLKGLGSNRNVACDAYSPETDTWTPVSNGMVNGWRNPSISLNGQLYALECQDGCKLNVYDADTDSWKKFIDSKLHLGSSSALDAAALVPLNGKLCIVRNNMSISLVDVSSPNKCVESNPLLWENIAGKGHASSFVRNLWSTIAGRGGLKSHIVHCQVLQV*
• ORF Type: complete

Annotations of Ll_transcript_160256

• Blastp: F-box/kelch-repeat protein At1g55270 from Arabidopsis with 77.96% of identity
• Blastx: F-box/kelch-repeat protein At1g55270 from Arabidopsis with 77.96% of identity
• Eggnog: Kelch repeat-containing F-box family protein(ENOG4110X8D)
• Kegg: Link to kegg annotations (AT1G55270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445262.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;