Protein coding transcript 186168

• Transcript: Ll_transcript_157772
• CDS coordinates: 2-439 (+)
• Peptide sequence: DAWFGSRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPINASIGNDNKSIEIRNFLGEKKVRKVDMLDGVNIIRSEKVKDELVLDGNDIELVSRSCALINQVCSSLSLFMHQRSQILSYFALAWIVLYLFPPSIFYWNRNA
• ORF Type: internal

Annotations of Ll_transcript_157772

• Blastp: 60S ribosomal protein L9 from Pisum with 93.52% of identity
• Blastx: 60S ribosomal protein L9 from Pisum with 93.52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000385)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431546.1)
• Pfam: Ribosomal protein L6 (PF00347.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;