Protein coding transcript 186237

• Transcript: Ll_transcript_160156
• CDS coordinates: 220-669 (+)
• Peptide sequence: MWVKNVKSVVLLFAAFSFVLFEPATSLNRSSFPQDFLFGTASSAYQYEGAAREGGRGPSIWDTFTHSHKDRIADHSTGDVAVDSYHRYKEDVAMMKDIGFNAYRFSISWSRILPRGNLKGGVNREGVSYYNNLINELISNGKHFLSFTL*
• ORF Type: complete

Annotations of Ll_transcript_160156

• Blastp: Beta-glucosidase 24 from Oryza sativa with 73.91% of identity
• Blastx: Beta-glucosidase 15 from Arabidopsis with 54.59% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (4340890)
• CantataDB: Link to cantataDB annotations (CNT0000240)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433126.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;