Protein coding transcript 186263

• Transcript: Ll_transcript_158612
• CDS coordinates: 410-715 (+)
• Peptide sequence: MGNVKANKYWEAELPPNFDRNGYGIEKFIRNKYAEKRWASKGGYHAATKLTDTIFNCNESPTGGTKSGIPRSRRLSLEESILVSHMAQVPPPVTRSREGSLD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_158612

• Blastp: Probable ADP-ribosylation factor GTPase-activating protein AGD15 from Arabidopsis with 44.12% of identity
• Blastx: Probable ADP-ribosylation factor GTPase-activating protein AGD15 from Arabidopsis with 42.99% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT3G17660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430496.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;