Transcript | Ll_transcript_158363 |
---|---|
CDS coordinates | 2-529 (+) |
Peptide sequence | LHQTKPEPIVHRDLKPSNILLTKNYVTKIADVGLARLVPPSAADKTTQYHMTATAGTFFYIDPEYQQTGLLGVKSDIYSFGVVLLQIITGKGPMGVARLVEEAIHEGKFEKVLDPNVTDWPVEETLSLARLALMCCEMRKRDRPDLGSVILPELNRLRDLGGVIDTDIVTATRNE* |
ORF Type | 5prime_partial |
Blastp | U-box domain-containing protein 34 from Arabidopsis with 56.05% of identity |
---|---|
Blastx | U-box domain-containing protein 34 from Arabidopsis with 56.05% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G19410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435819.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer