Transcript | Ll_transcript_159822 |
---|---|
CDS coordinates | 338-1027 (+) |
Peptide sequence | MASSLDSWTKEYNEAVKLADDISGMISERSSFPASGPETQRHSSAIRRKITILGTRLDSLQSLLSRNPGKSEKEFNRRKDTLSNLRSKVNQMASTLSMSNFANRDSLLGPDTKSDAMSRTVGLDNSGLVGLQRQIMKEQDEGLEKLEETVNSTKHIALAVNEELGLHTRLIDDLDEHVDVTDSRLRRVQKNLAVLNKRTQGGCSCLCMLLSVIGIVVLVVVIWLLVKYL* |
ORF Type | complete |
Blastp | Syntaxin-51 from Arabidopsis with 71.55% of identity |
---|---|
Blastx | Syntaxin-51 from Arabidopsis with 71.09% of identity |
Eggnog | syntaxin(ENOG410ZZA3) |
Kegg | Link to kegg annotations (AT1G16240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417968.1) |
Pfam | SNARE domain (PF05739.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer