Protein coding transcript 186310

• Transcript: Ll_transcript_159825
• CDS coordinates: 132-827 (+)
• Peptide sequence: MLMASSLDSWTKEYNEAVKLADDISGMISERSSFPASGPETQRHSSAIRRKITILGTRLDSLQSLLSRNPGKSEKEFNRRKDTLSNLRSKVNQMASTLSMSNFANRDSLLGPDTKSDAMSRTVGLDNSGLVGLQRQIMKEQDEGLEKLEETVNSTKHIALAVNEELGLHTRLIDDLDEHVDVTDSRLRRVQKNLAVLNKRTQGGCSCLCMLLSVIGIVVLVVVIWLLVKYL*
• ORF Type: complete

Annotations of Ll_transcript_159825

• Blastp: Syntaxin-51 from Arabidopsis with 71.55% of identity
• Blastx: Syntaxin-51 from Arabidopsis with 71.09% of identity
• Eggnog: syntaxin(ENOG410ZZA3)
• Kegg: Link to kegg annotations (AT1G16240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417968.1)
• Pfam: SNARE domain (PF05739.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;