Protein coding transcript 186393

• Transcript: Ll_transcript_159408
• CDS coordinates: 308-1006 (+)
• Peptide sequence: MGRGKIVIRRIDNSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLVIFSNTGKLYEYASTSMKSVVERYNTCKEENQQLINPESEVKFWQKEAGILRQQLQNLQENHRQMMGDQLSGLSVRNLQDLENQLEVSLQGVRMKKEQILTDEIRELNQKGNLIHQENVELYKKANLIQQENTQLCKKVYGTTDVAVRRNVFVPIPFDVDAGRDQQALIQLQLSQPDQETCETSGSGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_159408

• Blastp: Agamous-like MADS-box protein AGL21 from Arabidopsis with 65.07% of identity
• Blastx: Agamous-like MADS-box protein AGL21 from Arabidopsis with 65.07% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT4G37940)
• CantataDB: Link to cantataDB annotations (CNT0002701)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422741.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;