Protein coding transcript 186394

• Transcript: Ll_transcript_159410
• CDS coordinates: 4687-5049 (+)
• Peptide sequence: MCLIISLRTILITLKTINKHNQILQEQILTDEIRELNQKGNLIHQENVELYKKANLIQQENTQLCKKVYGTTDVAVRRNVFVPIPFDVDAGRDQQALIQLQLSQPDQETCETSGSGSSTK*
• ORF Type: complete

Annotations of Ll_transcript_159410

• Blastp: Agamous-like MADS-box protein AGL17 from Arabidopsis with 45.65% of identity
• Blastx: MADS-box transcription factor 27 from Oryza sativa with 43.18% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G22630)
• CantataDB: Link to cantataDB annotations (CNT0002701)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422741.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;