Transcript | Ll_transcript_534281 |
---|---|
CDS coordinates | 2-313 (+) |
Peptide sequence | FTRDFEENGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCDALREVSAAREEVPGRRGYPGYMYTDLATMYERAGRVEGRNGS |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | V-type proton ATPase subunit B from Neurospora with 93.27% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU08515) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013470345.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer