Transcript | Ll_transcript_534282 |
---|---|
CDS coordinates | 3-455 (+) |
Peptide sequence | PHNEIAAQICRQAGLVQHKGKGSQDMHDDNFSIVFGAMGVNLETARFFTKDFEENGSMERVTMFTNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCDALREVSAAREEVPGRRGYPGYMYTDLATMYERAGRVEGRNGS |
ORF Type | internal |
Blastp | V-type proton ATPase subunit B from Neurospora with 87.01% of identity |
---|---|
Blastx | V-type proton ATPase subunit B from Neurospora with 87.01% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU08515) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003624258.1) |
Pfam | ATP synthase alpha/beta family, nucleotide-binding domain (PF00006.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer