Protein coding transcript 1865

• Transcript: Ll_transcript_534282
• CDS coordinates: 3-455 (+)
• Peptide sequence: PHNEIAAQICRQAGLVQHKGKGSQDMHDDNFSIVFGAMGVNLETARFFTKDFEENGSMERVTMFTNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCDALREVSAAREEVPGRRGYPGYMYTDLATMYERAGRVEGRNGS
• ORF Type: internal

Annotations of Ll_transcript_534282

• Blastp: V-type proton ATPase subunit B from Neurospora with 87.01% of identity
• Blastx: V-type proton ATPase subunit B from Neurospora with 87.01% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU08515)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003624258.1)
• Pfam: ATP synthase alpha/beta family, nucleotide-binding domain (PF00006.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;