Protein coding transcript 186591

• Transcript: Ll_transcript_159037
• CDS coordinates: 2-466 (+)
• Peptide sequence: CDTFLCNVLIDMYGKCGSVDNSVKVFKQMAYRNVITWTALITALGLNGYAREALERFQNMELMGLKPDALALRAVLSACRYGGLVSEGMEIFRHMGTKYGIQPEVDHYHCMVDLLAKNGQIKEAEKIIARMPFPPTANIWRSFLEGYKRQEIAN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_159037

• Blastp: Pentatricopeptide repeat-containing protein At3g58590 from Arabidopsis with 56.08% of identity
• Blastx: Probable serine protease EDA2 from Arabidopsis with 66.78% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G58590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004512112.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;