Protein coding transcript 186627

• Transcript: Ll_transcript_160100
• CDS coordinates: 36-515 (+)
• Peptide sequence: MIRVFPTQRFQRKLNAWKWHFHFSRVLLENSMNNSTFETSTPFICEKIQDFHPLGIIHGHNITHYNYSQLMFNFILVVAITKIIRLILKPLKQPKVVSQIIGGIVLGPSVLKHSTWFKHYIIHGGAEYLSRNLGVMGFMFYVFIYGVKMDPFLLRKTGKV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_160100

• Blastp: Cation/H(+) antiporter 25 from Arabidopsis with 30.92% of identity
• Blastx: Cation/H(+) antiporter 25 from Arabidopsis with 30.92% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT5G58460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439269.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;