Protein coding transcript 186637

• Transcript: Ll_transcript_159833
• CDS coordinates: 129-1061 (+)
• Peptide sequence: MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQVIYSGPLGRNSHKIVEYFEEIQGVPKIKDKYNPATWMLEVSSIAAEVRLGMDFAEYYKTSALAQRNRALVNELSVPPPGAKDLYFPSQFSQSIMGQFKSCLWKQYLTYWRCPDYNLVRYFFTLLVALVVGSVFWKVGKKRDSSSNLSTIIGVLYGSIFFVGVNNCQTVQPVVAIERTVFYRERAAGMYSALPYAIAQVIIEIPYCFVQTIVFGFIVYGMVSFEWQVAKVFWFLFVSFFTFLYFTYYGMMTVSITP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_159833

• Blastp: ABC transporter G family member 29 from Arabidopsis with 72.67% of identity
• Blastx: ABC transporter G family member 42 from Oryza sativa with 76.49% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (AT3G16340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448177.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;