Protein coding transcript 186645

• Transcript: Ll_transcript_159842
• CDS coordinates: 295-1431 (+)
• Peptide sequence: MKRGGQVIYSGPLGRNSHKIVEYFEEIQGVPKIKDKYNPATWMLEVSSIAAEVRLGMDFAEYYKTSALAQRNRALVNELSVPPPGAKDLYFPSQFSQSIMGQFKSCLWKQYLTYWRCPDYNLVRYFFTLLVALVVGSVFWKVGKKRDSSSNLSTIIGVLYGSIFFVGVNNCQTVQPVVAIERTVFYRERAAGMYSALPYAIAQVIIEIPYCFVQTIVFGFIVYGMVSFEWQVGKVFWFLFVSFFTFLYFTYYGMMTVSITPNHQVASIFGAAFYGIFNLFSGFFIARPKIPKWWVWYYWICPIAWTVYGLIVSQYRDVMDEIEVPGWNYKPMIKDYIDLQYGFKANFMGPVAAVLVAFPVFFAFVFATGIKMLNFQTR*
• ORF Type: complete

Annotations of Ll_transcript_159842

• Blastp: ABC transporter G family member 29 from Arabidopsis with 67.2% of identity
• Blastx: ABC transporter G family member 29 from Arabidopsis with 65.32% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (AT3G16340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448177.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;