Protein coding transcript 186748

• Transcript: Ll_transcript_158486
• CDS coordinates: 404-919 (+)
• Peptide sequence: MSPFLSTSRALRSLGKSGVTQSIRYNKSGFRYSTTTHQIQTRFFASRIGSSQFMGGYCNNINNYNDCNYNYNYVQTRQFLGCGDGEEGVLTRSYEERIVLGYTPEQLFDVVAAVDFYHGFVPWCQRSEIIKHFPDGSFDAELEIGFKFLVESYVSHVELERPKRIKVFNLM*
• ORF Type: complete

Annotations of Ll_transcript_158486

• Blastp: Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Xenopus with 41.38% of identity
• Blastx: Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Danio with 43.04% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444305)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437957.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF03364.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;