Protein coding transcript 186749

• Transcript: Ll_transcript_158487
• CDS coordinates: 400-1176 (+)
• Peptide sequence: MSPFLSSYRALLRSLASEKTGLIQSIKHSKNSGKVNGCRCLTTMASRTIHHHQIHLSDSRIRSSSSLGGFCNINNNNYYNNFVQTRQFLGCGDGEEGVLTRTYEERRVLGYSPEQLFGVVAAVDFYHGFVPWCQRSEILKHYPDGSFDAELEIGFKFLVESYVSHVELERPKRIKTTVSQSNLFDHLINIWEFSPGPVPGTCNLHFLVDFKFQSPLYRQIASMFFKEVASRMVGSFSERCRLIYGPEVRVLEKSYGEM*
• ORF Type: complete

Annotations of Ll_transcript_158487

• Blastp: Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Pongo with 42.48% of identity
• Blastx: Coenzyme Q-binding protein COQ10 homolog, mitochondrial from Danio with 41.78% of identity
• Eggnog: Cyclase dehydrase(COG2867)
• Kegg: Link to kegg annotations (100172009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414811.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF03364.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;