Protein coding transcript 186755

• Transcript: Ll_transcript_158506
• CDS coordinates: 2398-2892 (+)
• Peptide sequence: MLLILNIFLLYLINSPAASLAGVAVLIILAYRFRTKIFLPTYLLFRKSNPTNLIIEKFLKEHGDLPTARYSYSEVKKMTNSFINRVGQGGFGCVYKGKLQDGRDVAVKVLTESKADGEEFINEVASISRTSHVNIVRLLGFSLNGSKRALIYEFMPNGSLEKFI*
• ORF Type: complete

Annotations of Ll_transcript_158506

• Blastp: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4 from Arabidopsis with 52.26% of identity
• Blastx: Rust resistance kinase Lr10 from Triticum with 53.24% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G66920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441416.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;