Transcript | Ll_transcript_160272 |
---|---|
CDS coordinates | 3-419 (+) |
Peptide sequence | VPCVLDWEVNDQLLKVKADIGEASKNPQDLLLEAIHSAGFSGALANPLLASESAINGLNGTILEEFVVENYTAPRIVLAASGVEHEDLLSIAEPLLCDLPSGPYPEESKLVYTSVFRIKYLSSLTLFGWPKNPFCSCI* |
ORF Type | 5prime_partial |
Blastp | Mitochondrial-processing peptidase subunit alpha from Solanum with 60.16% of identity |
---|---|
Blastx | Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial from Arabidopsis with 65.77% of identity |
Eggnog | peptidase'(COG0612) |
Kegg | Link to kegg annotations (102580877) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446405.1) |
Pfam | Peptidase M16 inactive domain (PF05193.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer