Protein coding transcript 186843

• Transcript: Ll_transcript_160269
• CDS coordinates: 497-916 (+)
• Peptide sequence: MFPAFLDWEVNDQLLKVKADIGEASKNPQDLLLEAIHSAGFSGALANPLLASESAINGLNGTILEEFVVENYTAPRIVLAASGVEHEDLLSIAEPLLCDLPSGPYPEESKLVYTSVFRIKYLSSLTLFGWPKNPFCSCI*
• ORF Type: complete

Annotations of Ll_transcript_160269

• Blastp: Mitochondrial-processing peptidase subunit alpha from Solanum with 61.72% of identity
• Blastx: Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial from Arabidopsis with 58.12% of identity
• Eggnog: peptidase'(COG0612)
• Kegg: Link to kegg annotations (102580877)
• CantataDB: Link to cantataDB annotations (CNT0000680)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003630686.1)
• Pfam: Peptidase M16 inactive domain (PF05193.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;