Transcript | Ll_transcript_158208 |
---|---|
CDS coordinates | 314-697 (+) |
Peptide sequence | MSTEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICSDILTIIDEHLIPSSSSAEANVFYYKM* |
ORF Type | complete |
Blastp | 14-3-3 protein 7 from Lycopersicon with 79.03% of identity |
---|---|
Blastx | 14-3-3 protein 7 from Lycopersicon with 79.03% of identity |
Eggnog | Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040) |
Kegg | Link to kegg annotations (544213) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016199619.1) |
Pfam | 14-3-3 protein (PF00244.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer