Protein coding transcript 186862

• Transcript: Ll_transcript_158213
• CDS coordinates: 57-365 (+)
• Peptide sequence: MVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYCQKVEDELAKICSDILAIIDEHLIPSSTSAEANVFYYKM*
• ORF Type: complete

Annotations of Ll_transcript_158213

• Blastp: 14-3-3-like protein GF14 iota from Arabidopsis with 84.31% of identity
• Blastx: 14-3-3-like protein GF14 iota from Arabidopsis with 84.47% of identity
• Eggnog: Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040)
• Kegg: Link to kegg annotations (AT1G26480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462333.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;