Transcript | Ll_transcript_158213 |
---|---|
CDS coordinates | 57-365 (+) |
Peptide sequence | MVECMKKVAKLDLELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYCQKVEDELAKICSDILAIIDEHLIPSSTSAEANVFYYKM* |
ORF Type | complete |
Blastp | 14-3-3-like protein GF14 iota from Arabidopsis with 84.31% of identity |
---|---|
Blastx | 14-3-3-like protein GF14 iota from Arabidopsis with 84.47% of identity |
Eggnog | Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040) |
Kegg | Link to kegg annotations (AT1G26480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462333.1) |
Pfam | 14-3-3 protein (PF00244.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer