Protein coding transcript 186863

• Transcript: Ll_transcript_158214
• CDS coordinates: 1-363 (+)
• Peptide sequence: FLPLLTRIPFLLILLLLLLPFPLSNQPLLFSFLLFLSFFIYLSLSQTMSAEKERETQVYLAKLSEQAERYEEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARKASWRIMYSIEQKEE
• ORF Type: internal

Annotations of Ll_transcript_158214

• Blastp: 14-3-3-like protein from Nicotiana with 81.69% of identity
• Blastx: 14-3-3-like protein D from Soja with 81.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107784347)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462333.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;