Protein coding transcript 186865

• Transcript: Ll_transcript_158200
• CDS coordinates: 1-525 (+)
• Peptide sequence: FLPLLTRIPFLLILLLLLLPFPLSNQPLLFSFLLFLSFFIYLSLSQTMSAEKERETQVYLAKLSEQAERYEEMVECMKKIAKLDLELTVEERNLLSVGYKNVIGARRASWRIMSSIQQKEESKGNENNVKLIKSYCQKVEEELSKICSDILEIIDKHLIPSSTSGEATVFYHKM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_158200

• Blastp: 14-3-3 protein 7 from Lycopersicon with 79.03% of identity
• Blastx: 14-3-3 protein 7 from Lycopersicon with 79.03% of identity
• Eggnog: Tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein(COG5040)
• Kegg: Link to kegg annotations (544213)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004490160.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;