Transcript | Ll_transcript_392434 |
---|---|
CDS coordinates | 1324-1950 (+) |
Peptide sequence | MPGFTAYAGFYEVCSPRKGEYVFVSAASGAVGQLVGQLAKLHGCYVVGSAGSKEKVEILKNKLGFDEAFNYKEESDLDAALKRYFPQGIDIYFDNVGGDMLDATLLNMNIHGRIAVCGMVSQQNLSTPKGIHNLLNLVTRRIRMQGFLQSDYLHLYPQFLEHVASSYKQGKILYIEDMNEGLESAPAAFTGLFYGKNIGKQVICVTRE* |
ORF Type | complete |
Blastp | 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 72.12% of identity |
---|---|
Blastx | 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 67.16% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (BAA89423) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443107.1) |
Pfam | Zinc-binding dehydrogenase (PF00107.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer