Protein coding transcript 18692

• Transcript: Ll_transcript_392443
• CDS coordinates: 206-1243 (+)
• Peptide sequence: MGEVENNKQVIFKGYIDGVPKETDLEIKVTKTELKLPHNGSEAILVKNLYLSCDPYMRGRMRDFHDSYIPPFVPTQVLEGFGVSKVIDSDHPNFKPGDFISGFTGWEQYSLIKKTEQLRKIKPDDDIPLSFHVGLLGMPGFTAYAGFYEVCSPRKGEYVFVSAASGAVGQLVGQLAKLHGCYVVGSAGSKEKVEILKNKLGFDEAFNYKEESDLDAALKRYFPQGIDIYFDNVGGDMLDATLLNMNIHGRIAVCGMVSQQNLSTPKGIHNLLNLVTRRIRMQGFLQSDYLHLYPQFLEHVASSYKQGKILYIEDMNEGLESAPAAFTGLFYGKNIGKQVICVTRE*
• ORF Type: complete

Annotations of Ll_transcript_392443

• Blastp: 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 64.35% of identity
• Blastx: 2-alkenal reductase (NADP(+)-dependent) from Nicotiana with 64.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAA89423)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443107.1)
• Pfam: N-terminal domain of oxidoreductase (PF16884.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;