Protein coding transcript 186969

• Transcript: Ll_transcript_158712
• CDS coordinates: 880-1335 (+)
• Peptide sequence: MCNKLASRHVRVGLASPSAVPRCDICENAPAFFFCETDGSSLCLQCDMLVHVGGKRTHGRYLLFRQRVEFPGDKPNHAENPLSQPVGPGETKRGQNSLPRPKMGEKQQNHRMPMLPSPEPGADGQTKMETEMFDLNMNPNRIHEHTSNNQP*
• ORF Type: complete

Annotations of Ll_transcript_158712

• Blastp: B-box zinc finger protein 19 from Arabidopsis with 57.05% of identity
• Blastx: B-box zinc finger protein 19 from Arabidopsis with 57.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G38960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421819.1)
• Pfam: B-box zinc finger (PF00643.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;