Transcript | Ll_transcript_158699 |
---|---|
CDS coordinates | 285-839 (+) |
Peptide sequence | MRTLCDACESAAAIVFCAADEAALCRACDEKVHMCNKLASRHVRVGLASPSAVPRCDICENAPAFFFCETDGSSLCLQCDMLVHVGGKRTHGRYLLFRQRVEFPGDKPNHAENPLSQPVGPGETKRGQNSLPRPKMGEKQQNHRMPMLPSPEPGADGQTKMETEMFDLNMNPNRIHEHTSNNQP* |
ORF Type | complete |
Blastp | B-box zinc finger protein 19 from Arabidopsis with 62.3% of identity |
---|---|
Blastx | B-box zinc finger protein 19 from Arabidopsis with 62.3% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT4G38960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421819.1) |
Pfam | B-box zinc finger (PF00643.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer