Protein coding transcript 1870

• Transcript: Ll_transcript_534294
• CDS coordinates: 1-393 (+)
• Peptide sequence: EKPENGEQAPLTRVIWEYFHIIVGRSAIVVSVVALFSGVKHLGDRYGAQNVQGPNWAMAIWFLIGVLVVIYLEYREKQRVRDHIFGRSNWVLGNLEEDDSLDLLSPVRTLADIESQSSVRMEVQLEPLNR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_534294

• Blastp: Cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 from Arabidopsis with 53.49% of identity
• Blastx: Cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 from Arabidopsis with 53.49% of identity
• Eggnog: domon domain-containing protein(ENOG410XSWZ)
• Kegg: Link to kegg annotations (AT5G54830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435091.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;