Transcript | Ll_transcript_157666 |
---|---|
CDS coordinates | 1-861 (+) |
Peptide sequence | DNTSSSQSESTTPPPPTTTTTINIENVAGVSSAESPVAVSDEAVVVAAEKESETRSSVETVNVNGNEGGKSDDVVPAPAHIPELRKRRPRERKVPSTPFSRALGFAGLGAGLAWGTLQESTKRLVYGTPSQGNQPVFSPFLSEQNAERLALALCRMRGAALKIGQMLSIQDESLVPAPILAALEIVRQGADVMPKSQLNQVLNAELGPDWSSKLISFDYEPLAAASIGQVHRAVIKDGMHVAMKIQYPGVADSIESDIENVKLLLNYTNLIPEGLYLDRAIKVHIC* |
ORF Type | 5prime_partial |
Blastp | Protein ABC transporter 1, mitochondrial from Arabidopsis with 70.8% of identity |
---|---|
Blastx | Protein ABC transporter 1, mitochondrial from Arabidopsis with 77.49% of identity |
Eggnog | Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661) |
Kegg | Link to kegg annotations (AT4G01660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441253.1) |
Pfam | ABC1 family (PF03109.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer