Transcript | Ll_transcript_157667 |
---|---|
CDS coordinates | 1-567 (+) |
Peptide sequence | DNTSSSQSESTTPPPPTTTTTINIENVAGVSSAESPVAVSDEAVVVAAEKESETRSSVETVNVNGNEGGKSDDVVPAPAHIPELRKRRPRERKVPSTPFSRALGFAGLGAGLAWGTLQESTKRLVYGTPSQGNQPVFSPFLSEQNAERLALALCRMRGAALKIGQMLSIQDESLVPAPVLWHIFMLVA* |
ORF Type | 5prime_partial |
Blastp | Protein ABC transporter 1, mitochondrial from Arabidopsis with 59.35% of identity |
---|---|
Blastx | Protein ABC transporter 1, mitochondrial from Arabidopsis with 84% of identity |
Eggnog | Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661) |
Kegg | Link to kegg annotations (AT4G01660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441253.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer