Protein coding transcript 187099

• Transcript: Ll_transcript_157673
• CDS coordinates: 1-567 (+)
• Peptide sequence: DNTSSSQSESTTPPPPTTTTTINIENVAGVSSAESPVAVSDEAVVVAAEKESETRSSVETVNVNGNEGGKSDDVVPAPAHIPELRKRRPRERKVPSTPFSRALGFAGLGAGLAWGTLQESTKRLVYGTPSQGNQPVFSPFLSEQNAERLALALCRMRGAALKIGQMLSIQDESLVPAPVLWHIFMLVA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_157673

• Blastp: Protein ABC transporter 1, mitochondrial from Arabidopsis with 59.35% of identity
• Blastx: Protein ABC transporter 1, mitochondrial from Arabidopsis with 75% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT4G01660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441253.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;