Protein coding transcript 187205

• Transcript: Ll_transcript_158167
• CDS coordinates: 411-785 (+)
• Peptide sequence: MCAHLQGREIPIVHRVIQVHEPNNVKETFMLTKGDNNPMDDRVLYNYGQNWLQRHHIMGRAVGILPYAGWMTIIMTENPIVKCETLPCVSRFHLADVVVLFFPFLLKLGVKNDQYLVLCFVIFP*
• ORF Type: complete

Annotations of Ll_transcript_158167

• Blastp: Signal peptidase complex catalytic subunit SEC11C from Pongo with 53.33% of identity
• Blastx: Signal peptidase complex catalytic subunit SEC11C from Pongo with 53.33% of identity
• Eggnog: Signal peptidase i(COG0681)
• Kegg: Link to kegg annotations (100174381)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416141.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;