Protein coding transcript 187238

• Transcript: Ll_transcript_158942
• CDS coordinates: 321-1364 (+)
• Peptide sequence: MDLTPTTGTDTQTPPPTQPIKLNPSKSLSFTNGTLKPHTTVVPPPSQPPYMVVSYKECLKNHAASIGGHALDGCGEFMPSSTTNPTDPRSLKCAACGCHRNFHRRDPQEHHQQQQPPQPNFLTCFYSTTPSSVTPTAPPPQPPPPQLPHRAMSQSTSPSLSSSPSHSHSPMSSTPSSPPPLSHVPPSYSAPHMLLSLGNNNNAYSIDHQNRNFHSSSLVMRTETINLSGKKRYRTKFSQEQKEKMFSFSEKLGWRMQKSDDGSVQEFCNDIGVPRGVFKVWMHNNKNTLRKKSEVGNDGTPPQIEKTNVNGDDINNSFNINSSSNNDIHKNEDNCVDVHVSFNGLPS*
• ORF Type: complete

Annotations of Ll_transcript_158942

• Blastp: Zinc-finger homeodomain protein 11 from Arabidopsis with 47.11% of identity
• Blastx: Zinc-finger homeodomain protein 8 from Arabidopsis with 59.77% of identity
• Eggnog: homeobox protein(ENOG410YKTX)
• Kegg: Link to kegg annotations (AT1G69600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445943.1)
• Pfam: ZF-HD protein dimerisation region (PF04770.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;