Protein coding transcript 187240

• Transcript: Ll_transcript_158953
• CDS coordinates: 366-1400 (+)
• Peptide sequence: MDLTPTICKDTQTPPLTQPINLNPPKSLSFTNGTLKPHSSTTTASATVPPPSSIVVSYKECLKNHAASIGGHAIDGCGEFMASSTAIPTDPRSLICAACGCHRNFHRRDPQEPQPPPPTFLTCFYSTTPSSVTPTAPPPPPQLPHRAMSQSTSPSLSSSPSHSPSPISSTPSSPPPLSHVPPSSYAAPHMLLALGNNNNAYSIDYQNRNFHSSSLVLKTETINLSGKKRYRTKFSLEQKEKMFRFSEKLGWRMQKGDDRSVQEFCSEIGVPRGVFKVWMHNNKNTLRKKSESAPQIEKTNSDKEVGNGDGINNSFNINCSNNNDIHKNEDNCVDVHVSFNGLSS*
• ORF Type: complete

Annotations of Ll_transcript_158953

• Blastp: Zinc-finger homeodomain protein 9 from Arabidopsis with 38.02% of identity
• Blastx: Zinc-finger homeodomain protein 8 from Arabidopsis with 52% of identity
• Eggnog: homeobox protein(ENOG410YKTX)
• Kegg: Link to kegg annotations (AT3G28920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433688.1)
• Pfam: ZF-HD protein dimerisation region (PF04770.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;