Transcript | Ll_transcript_158558 |
---|---|
CDS coordinates | 98-718 (+) |
Peptide sequence | METSNTFILPLHELNNLRPQLYSAAEYCQNSYLHTHQKQMVLDNLKDYAVRALVNVVDHLGTVAYKLTNLLEHQTLDVSTMDLKISTLNQKLHTCLIYTDKEGLRQQQLLAMIPRHHKHYILPNSANKKVHFNPKIQTDARQDQLQTRKHNQSSGIPVAKTLSWHLASETKSTLKKRAPRSSTKIKDQKICAKTCGVFQLIGMLNS* |
ORF Type | complete |
Blastp | Protein ABIL1 from Arabidopsis with 62.44% of identity |
---|---|
Blastx | Protein ABIL1 from Arabidopsis with 62.44% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT2G46225) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425182.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer