Protein coding transcript 187273

• Transcript: Ll_transcript_158558
• CDS coordinates: 98-718 (+)
• Peptide sequence: METSNTFILPLHELNNLRPQLYSAAEYCQNSYLHTHQKQMVLDNLKDYAVRALVNVVDHLGTVAYKLTNLLEHQTLDVSTMDLKISTLNQKLHTCLIYTDKEGLRQQQLLAMIPRHHKHYILPNSANKKVHFNPKIQTDARQDQLQTRKHNQSSGIPVAKTLSWHLASETKSTLKKRAPRSSTKIKDQKICAKTCGVFQLIGMLNS*
• ORF Type: complete

Annotations of Ll_transcript_158558

• Blastp: Protein ABIL1 from Arabidopsis with 62.44% of identity
• Blastx: Protein ABIL1 from Arabidopsis with 62.44% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G46225)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425182.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;