Protein coding transcript 187323

• Transcript: Ll_transcript_158301
• CDS coordinates: 1816-2316 (+)
• Peptide sequence: MIGLRSYISLVNNLQKKNLFSLLHLYLTETSISLLYIDNGGSILTWNTQTWKRINSKRIIRDAISALNVSADGKFLACGTPSGDIITVSSKNMQIQTIIKKAHLGIVTALAFSPDSRALASVSMDSSARVTLIEEKKNGGLSLWIALFILLLSVAVYFQKIKGIEK*
• ORF Type: complete

Annotations of Ll_transcript_158301

• Blastp: SEC12-like protein 2 from Arabidopsis with 48.41% of identity
• Blastx: SEC12-like protein 2 from Arabidopsis with 47.13% of identity
• Eggnog: Prolactin regulatory element binding(ENOG410XRQK)
• Kegg: Link to kegg annotations (AT2G01470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445844.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;