Protein coding transcript 187412

• Transcript: Ll_transcript_157727
• CDS coordinates: 471-866 (+)
• Peptide sequence: MCSAEKEIQIQTPFTRKPLSPVSPSVLSKANINSHDDHKKIPKMSQKGQMLTRIPPSKPVNVGDEENRTPKNMGLPIPTTPLTSFPMLNATTPETPSSYSSSIIAAKNAQPLEYSFEEVRSGFILPKTYAN*
• ORF Type: complete

Annotations of Ll_transcript_157727

• Blastp: 65-kDa microtubule-associated protein 4 from Arabidopsis with 37.17% of identity
• Blastx: 65-kDa microtubule-associated protein 3 from Arabidopsis with 47.37% of identity
• Eggnog: protein regulator of cytokinesis(ENOG410YZBK)
• Kegg: Link to kegg annotations (AT3G60840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432940.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;