Protein coding transcript 187438

• Transcript: Ll_transcript_160173
• CDS coordinates: 2479-3162 (+)
• Peptide sequence: MYFLRFPVYRLDQTKNSIAASKDQDTSFFRKLDGFQPCELTELKAGTHVFAIYGDNFFRSANYTIEAVCAAPFSEEKESLRNIESQILSKRAEMSKFETEYREVLAQFTEMTSKYAHEMQAVSFSFSRFSMQHPPSPFPLLKNSPISIELLLYIFVQIDELLKQRNEIHASYSVAPLKRSSSKSRGKSSAKEAKEDDQVREKRNIRDRPRKKKWYNIHLRVDKRKAC*
• ORF Type: complete

Annotations of Ll_transcript_160173

• Blastp: Chaperone protein dnaJ 16 from Arabidopsis with 48.24% of identity
• Blastx: Chaperone protein dnaJ 16 from Arabidopsis with 82.54% of identity
• Eggnog: DNAj domain protein(COG2214)
• Kegg: Link to kegg annotations (AT1G24120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445496.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;