Protein coding transcript 1875

• Transcript: Ll_transcript_534303
• CDS coordinates: 745-1059 (+)
• Peptide sequence: MLLMKKKDGSWRMCVDYRDLNAITIRDHFPLPTIDELLDELGMARIFSKLDLTSGFHQIRIAPEDISKTSFRTHDGHYEYCAMPFGLSNAPATFQATMIRKCNL*
• ORF Type: complete

Annotations of Ll_transcript_534303

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 58.16% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 53.38% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017426291.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;