Transcript | Ll_transcript_159917 |
---|---|
CDS coordinates | 1824-2705 (+) |
Peptide sequence | MSTVSSLTGLSSASSFTNFHRGAWCTPPRMFLEDQFDVVPPETASVSSLGKKSVRDESVKKKNHAPVKISPWALARLNAEEVSKAAAEARKKSKILQPVTRHDTPFRLEPDNNSGSSGRRMVPRIDNNRRRASKRVRMPADLPMESLTRFSANNIIDKGFSATSSLATMQVEPRSGFQTMQAVSSSAGIIASSPESSLDSPDIHPFRVSSTDAEEARRLAGLSAAGAAALKGIPLSRSTSDGYDASGGEDSDRVPTRIVQRSTNWSNLLFSVDREEMAFEPKSSSSMVHNRKL* |
ORF Type | complete |
Blastp | Probable protein S-acyltransferase 22 from Arabidopsis with 60.78% of identity |
---|---|
Blastx | Probable protein S-acyltransferase 22 from Arabidopsis with 68.08% of identity |
Eggnog | Zinc finger, DHHC-type containing(COG5273) |
Kegg | Link to kegg annotations (AT1G69420) |
CantataDB | Link to cantataDB annotations (CNT0002609) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433396.1) |
Pfam | - |
Rfam | Intron_gpII (RF00029) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer